PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0032300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 772aa    MW: 84502.1 Da    PI: 6.2798
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0032300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK887.6e-28460510252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek+isle+l+++Fs+++k+AAk Lgvc+T+LKriCRq+GI RWP Rkik++
  Spipo17G0032300 460 EKTISLEVLRQHFSGSLKEAAKVLGVCPTTLKRICRQHGITRWPARKIKKV 510
                      79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.938445530IPR003035RWP-RK domain
PfamPF020422.0E-25462510IPR003035RWP-RK domain
SuperFamilySSF542771.14E-20663745No hitNo description
PROSITE profilePS5174521.945663746IPR000270PB1 domain
SMARTSM006664.2E-23663746IPR000270PB1 domain
PfamPF005641.7E-15665745IPR000270PB1 domain
CDDcd064072.48E-38665745No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-20665745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MEDDLFLLDS GDLFLPEDVW LGNLDLPEQV PPSATSPAQA ESRALCPRTG AGSGLGSSLR  60
EKLSRALGWI RDSYRDCEVL IQVWVPTEGA EGLVLTTSSE PFALAPGCER LLNYRAVSTC  120
FQFSAGENSG GALGLPGRVF QGKLPEWSPD VRYFSNYEYP RVNYAQQCDV RGSLALPVFH  180
HHRGGGGGRL SCLGVIEVVM TTERINYRSD YEHICSALQA VDLSSSEALN APRVEVRSDF  240
QLAGLPEIAA ALRASCRAHG FALAQAWIPC ARQGRSGSRH SDGNYEDCIS TVDALCCVND  300
PALAGFHEAC SEHHLLRGQG IVGKAFLMNR PWFSSDITAP CKTEYPLSHH ARMLGLGAAA  360
AVCLHRGAAT GKAEIVLEFI LPKECRRSEE QAAMVNAMLV TVRQACPSWH VLAERQLEEE  420
GLLQVNPQPA SASSENAQES GYYSSPAGDK AKGSKLTKTE KTISLEVLRQ HFSGSLKEAA  480
KVLGVCPTTL KRICRQHGIT RWPARKIKKV GHSLKKLQVV IDSVQGIDGA VHLSSLYDDV  540
RRAPGLVEQE AGKKNVITSL YRSDDQELPS TSNPLSSSCT SGSSRGCSIG REGSSHVPDG  600
PSEEAPFVEE NGGTTWRFSD ELERDYPTEG IPATRDQLQT SGSLGDHSDL KTPFQNKHAA  660
RGLPRVKATH GEEKIRFSLK PNWGVHEVMQ EISKRFNISD MNSVDLRYLD DESEWVLLRC  720
DDDLQVCADL YRTSRIHTIK ISVHHADRPS FMPFGSEDYD LLGYIPRPFT E*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.21e-175Nin-like family protein